- OSBPL9 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-86390
- Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- PBS (pH 7.2) and 40% Glycerol
- Human
- Unconjugated
- OSBPL9
- ORP-9, ORP9
- 0.1 ml (also 25ul)
- Rabbit
- This antibody was developed against Recombinant Protein corresponding to amino acids: PSPLEPVIST MPSQTVLPPE PVQLCKSEQR PSSLPVGPVL ATLGHHQTPT PNSTGSGHSP PSSSLTSPSH VNLSPNTV
- oxysterol binding protein like 9
- IgG
- Polyclonal
- Immunogen affinity purified
- Novus Biologicals, a Bio-Techne Brand
- Lipid and Metabolism
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
PSPLEPVISTMPSQTVLPPEPVQLCKSEQRPSSLPVGPVLATLGHHQTPTPNSTGSGHSPPSSSLTSPSHVNLSPNTV
Specifications/Features
Available conjugates: Unconjugated